Mouse Monoclonal IgG Anti-DOG1 (Discovered on GIST 1) [DOG1.1]
448 EUR
1 ml
DOG001
Please contact us to check the availability
Synthetic peptide (FLJ34272) human DOG1 sequence: MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL .
Human DOG1, gastrointestinal stromal tumours (GIST)
Human, chicken, hamster, rat
Antibody solution in stabilizing phosphate buffer pH 7.3. Contains 0.09 % sodium azide**. Use appropriate antibody diluent e.g. Gentaur Art . No. PU002.
Primary Antibody
Mouse
IgG
DOG1.1
liquid concentrate
1-2 µg/ml
50 µg/ml
GIST
Heat pre-treatment of formalin-fixed tissue with Unmasking Fluid C or G (Art. No. DE000 and DE007)
IHC(C, P)
We recommend the use of Gentaur's Universal Staining System DAB (Art. No. DA005) or AEC (Art.-No. AE005), VECTASTAIN Elite ABC (Art. No. PK-6102) or ABC AP (Art. No. AK-5002) or ImmPress Micro-polymer kits are suitable.
Store at 2-8°C
Go to UniProt/SwissProt
1. West R.B., et al. (2004) The novel marker , DOG1, is expressed ubiquitously in gastrointestinal stromal tumours irrespective of KIT or PDGFRA mutation. Am J. Pathol. 165(1) 107-113. 2. Espinosa I., et al.(2008) A novel monoclonal antibody against DOG1 is a sensitive and specific marker for gastrointestinal stromal tumours. Am J. Surg. Pathol 32(2)210-218 3. Liegl B., et al. (2009) Monoclonal antibody DOG1.1 shows higher sensitivity than KIT in the diagnosis of gastrointestinal stromal tumours, including unusual subtypes. Am. J. Surg. Pathol 33(3) 437-446.
*Gentaur's antibodies are intended for in vitro research use only. They must not be used for clinical diagnostics and not for in vivo experiments in humans or animals. ** The preservative sodium azide is known to be poisonous and potentially hazardous to health. It should be handled only by trained staff. Despite of the product's low azide concentration it must be handled with care. Dispose according to regional rules!
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Immunoglobulin gamma, IgG, mouse monoclonal H&L chain clones or rabbit, goat polyclonal antibodies have 4 parts. There are 2 heavy chains, 2 light chains. The IgG antibody has 2 antigen binding sites. They represent 70% or more of serum antibodies. This antibody can be antigen purified or protein A or G purified. For storage sodium azide is added or you can call us to request azide free antibody preparations. These will need colder storage temperatures.Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
IgG
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Mus musculus
![Mouse Monoclonal IgG Anti-DOG1 (Discovered on GIST 1) [DOG1.1]](/images/sedna/products/medium/2.jpg)